PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_1BL_CF98E922B.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family MYB
Protein Properties Length: 459aa    MW: 50686.4 Da    PI: 5.1007
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_1BL_CF98E922B.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding47.83.4e-154289148
                           TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
        Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                           +g+WT+ Ed +l  +vk++G  +W+ + +  g+ R++k+c++rw ++l
  Traes_1BL_CF98E922B.1 42 KGPWTPAEDAILEAYVKKHGVQNWNVVQKDTGLLRCGKSCRLRWANHL 89
                           79******************************99**********9986 PP

2Myb_DNA-binding49.78.2e-1695138146
                            TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
        Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                            +g +T+eE+ l+++++ ++G++ W++ a++++ gRt++++k++w++
  Traes_1BL_CF98E922B.1  95 KGTFTKEEENLIIKLHSKMGNK-WARMAARLP-GRTDNEIKNYWNT 138
                            799*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.623789IPR017930Myb domain
SuperFamilySSF466892.88E-2939136IPR009057Homeodomain-like
SMARTSM007172.0E-134191IPR001005SANT/Myb domain
PfamPF002499.6E-144289IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.9E-234396IPR009057Homeodomain-like
CDDcd001671.11E-104489No hitNo description
PROSITE profilePS5129424.43190144IPR017930Myb domain
SMARTSM007172.2E-1694142IPR001005SANT/Myb domain
PfamPF002496.4E-1595138IPR001005SANT/Myb domain
CDDcd001672.99E-1297138No hitNo description
Gene3DG3DSA:1.10.10.604.3E-2597142IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 459 aa     Download sequence    Send to blast
MTRAKSESDR VMPGPDQADL ASHDDDSARE SPRRRAGPQL KKGPWTPAED AILEAYVKKH  60
GVQNWNVVQK DTGLLRCGKS CRLRWANHLR PDLKKGTFTK EEENLIIKLH SKMGNKWARM  120
AARLPGRTDN EIKNYWNTRI KKCQRTSTPI YPAEICLQAS NEEQHESADF SFSEKLANDL  180
LHGNGLYDPS STWGDFIDDQ EALPYAPQLP DVSFSNLPGL YFESKNHGFM DQVNQAEVLK  240
ESEISFPWLN AAINGTFDGG HAFSNGNFST SRPMTGPWKM ELPSLQFAGS DPNNWSTYSR  300
TCAAQGANFA DPCMRSSAAM ASAKFEHMCM IPGNSGQLEE PLPEAHAVSS AENQQLSVGS  360
SSASTGSPCD AMVETSELHF LERDPNLYAL VNSCSPASPL CQASPDELPC SDFSSAASPV  420
FVSDEPTITQ YEKGFLLPHP EDSRADAFSH WNAMPPIFQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-30381423106B-MYB
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3750520.0AK375052.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv3084G04.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006644884.11e-151PREDICTED: transcription factor GAMYB
RefseqXP_006644885.11e-151PREDICTED: transcription factor GAMYB
SwissprotA2WW871e-151GAM1_ORYSI; Transcription factor GAMYB
SwissprotQ0JIC21e-151GAM1_ORYSJ; Transcription factor GAMYB
TrEMBLW5A6730.0W5A673_WHEAT; Uncharacterized protein
STRINGOB01G43550.11e-151(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP39473664
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06100.11e-64myb domain protein 33
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]